CJC-1295

No.CAS：863288-34-0

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland.

$4.00

Purity:

99%

Content:

2mg 5mg

Form:

Lyophilized powder

Transportation:

Door to door

GET A QUOTE

SPECIFICATION

CJC1295 Basic information

Product Name:	CJC1295
Synonyms:	CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG)
CAS:	863288-34-0
MF:	C152H252N44O42
MW:	3367.89688
EINECS:	206-141-6
Product Categories:	Peptides;CJC;863288-34-0
Mol File:	863288-34-0.mol

CJC1295 Chemical Properties

Melting point	> 177° C (dec.)
density	1.45
storage temp.	-20°C Freezer, Under inert atmosphere
solubility	Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
form	Solid
color	White to Off-White

CJC1295 Usage And Synthesis

Uses	CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.
Pharmacology	By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.
Clinical Use	CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.